PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_41406_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 114aa    MW: 13287.4 Da    PI: 10.4738
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_41406_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.91.3e-231059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien snr+vt+skRrng++KKA+E+ vL da+v+++i +s+gk++ey+s
  Neem_41406_f_1 10 RIENLSNRKVTYSKRRNGLIKKAKEIAVLYDAKVSLMIHASSGKMHEYCS 59
                    8***********************************************96 PP

2K-box39.32.8e-1469114146
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesL 46 
                     y+k+sgk+l++ak+e l++e++++k++++++q ++Rhl+Ged++ L
  Neem_41406_f_1  69 YHKQSGKKLWDAKHEDLSNEIERIKRKNDSMQIKLRHLKGEDISHL 114
                     899****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.09161IPR002100Transcription factor, MADS-box
CDDcd002652.02E-32278No hitNo description
SuperFamilySSF554554.58E-32293IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-24323IPR002100Transcription factor, MADS-box
PfamPF003198.1E-191057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-243859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-680114IPR002487Transcription factor, K-box
PROSITE profilePS512978.22682114IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MGRGKIEIRR IENLSNRKVT YSKRRNGLIK KAKEIAVLYD AKVSLMIHAS SGKMHEYCSS  60
NLVEILDSYH KQSGKKLWDA KHEDLSNEIE RIKRKNDSMQ IKLRHLKGED ISHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A6e-16287180MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B6e-16287180MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006472853.14e-61PREDICTED: floral homeotic protein GLOBOSA isoform X1
RefseqXP_006434290.15e-61hypothetical protein CICLE_v10002422mg
SwissprotQ074748e-58MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A067GP565e-61A0A067GP56_CITSI; Uncharacterized protein
TrEMBLV4T7S65e-61V4T7S6_9R
STRINGPOPTR_0005s20480.12e-58(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.15e-55MIKC_MADS family protein